SCOP 1.73: Domain d1i3va_: 1i3v A:

Lineage for d1i3va_ (1i3v A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)

7. Species Llama (Lama glama) [TaxId:9844] [88565] (8 PDB entries)

8. Domain d1i3va_: 1i3v A: [61637]

Details for d1i3va_

PDB Entry: 1i3v, 2.03 Å

PDB Description: three-dimensional structure of a lama vhh domain unliganded

PDB Compounds: (A:) antibody vhh lama domain

SCOP Domain Sequences for d1i3va_:

Sequence; same for both SEQRES and ATOM records:

>d1i3va_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsd
fytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywg
qgtqvtvss

Timeline for d1i3va_:

• d1i3va_ first appeared in SCOP 1.57
  
• d1i3va_ appears in SCOP 1.71
  
• d1i3va_ appears in SCOP 1.75
  
• d1i3va_ appears in the current release, SCOPe 2.08, called d1i3va1