Lineage for d1i3rh2 (1i3r H:1-120)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190467Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 190561Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (7 PDB entries)
  8. 190585Domain d1i3rh2: 1i3r H:1-120 [61635]
    Other proteins in same PDB: d1i3ra1, d1i3rb1, d1i3rc1, d1i3rd1, d1i3re1, d1i3rf1, d1i3rg1, d1i3rh1

Details for d1i3rh2

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule
PDB Compounds: (H:)

SCOP Domain Sequences for d1i3rh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3rh2 d.19.1.1 (H:1-120) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr

SCOP Domain Coordinates for d1i3rh2:

Click to download the PDB-style file with coordinates for d1i3rh2.
(The format of our PDB-style files is described here.)

Timeline for d1i3rh2: