SCOP 1.67: Domain d1i3rh1: 1i3r H:121-216

Lineage for d1i3rh1 (1i3r H:121-216)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1i3rh1: 1i3r H:121-216 [61634]
   Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb2, d1i3rc1, d1i3rc2, d1i3rd2, d1i3re1, d1i3re2, d1i3rf2, d1i3rg1, d1i3rg2, d1i3rh2
   contains covalently bound peptides at the N-termini of chains B, D, F and H
   complexed with nag; mutant

Details for d1i3rh1

PDB Entry: 1i3r, 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule

SCOP Domain Sequences for d1i3rh1:

Sequence; same for both SEQRES and ATOM records:

>d1i3rh1 b.1.1.2 (H:121-216) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group}
veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
fqtlvmletvpqsgevytcqvehpsltdpvtvewka

Timeline for d1i3rh1:

• d1i3rh1 first appeared in SCOP 1.57
  
• d1i3rh1 appears in SCOP 1.65
  
• d1i3rh1 appears in SCOP 1.69
  
• d1i3rh1 appears in the current release, SCOPe 2.08