![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
![]() | Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (7 PDB entries) |
![]() | Domain d1i3rh1: 1i3r H:121-216 [61634] Other proteins in same PDB: d1i3ra2, d1i3rb2, d1i3rc2, d1i3rd2, d1i3re2, d1i3rf2, d1i3rg2, d1i3rh2 contains covalently bound peptides at the N-termini of chains B, D, F and H complexed with nag; mutant |
PDB Entry: 1i3r (more details), 2.4 Å
SCOP Domain Sequences for d1i3rh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3rh1 b.1.1.2 (H:121-216) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK} veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt fqtlvmletvpqsgevytcqvehpsltdpvtvewka
Timeline for d1i3rh1: