Lineage for d1i3rf2 (1i3r F:1-120)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501462Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 501537Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)
  8. 501546Domain d1i3rf2: 1i3r F:1-120 [61631]
    Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb1, d1i3rc1, d1i3rc2, d1i3rd1, d1i3re1, d1i3re2, d1i3rf1, d1i3rg1, d1i3rg2, d1i3rh1

Details for d1i3rf2

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule

SCOP Domain Sequences for d1i3rf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3rf2 d.19.1.1 (F:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK}
gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr

SCOP Domain Coordinates for d1i3rf2:

Click to download the PDB-style file with coordinates for d1i3rf2.
(The format of our PDB-style files is described here.)

Timeline for d1i3rf2: