Lineage for d1i3rb1 (1i3r B:121-216)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760407Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1760505Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 1760514Domain d1i3rb1: 1i3r B:121-216 [61622]
    Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb2, d1i3rc1, d1i3rc2, d1i3rd2, d1i3re1, d1i3re2, d1i3rf2, d1i3rg1, d1i3rg2, d1i3rh2
    contains covalently bound peptides at the N-termini of chains B, D, F and H
    complexed with nag, ndg; mutant

Details for d1i3rb1

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule
PDB Compounds: (B:) fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain

SCOPe Domain Sequences for d1i3rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3rb1 b.1.1.2 (B:121-216) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
fqtlvmletvpqsgevytcqvehpsltdpvtvewka

SCOPe Domain Coordinates for d1i3rb1:

Click to download the PDB-style file with coordinates for d1i3rb1.
(The format of our PDB-style files is described here.)

Timeline for d1i3rb1: