Lineage for d1i3ra1 (1i3r A:82-182)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026687Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 2026795Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 2026804Domain d1i3ra1: 1i3r A:82-182 [61620]
    Other proteins in same PDB: d1i3ra2, d1i3rb1, d1i3rb2, d1i3rc2, d1i3rd1, d1i3rd2, d1i3re2, d1i3rf1, d1i3rf2, d1i3rg2, d1i3rh1, d1i3rh2
    complexed with nag, ndg; mutant

Details for d1i3ra1

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule
PDB Compounds: (A:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d1i3ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3ra1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

SCOPe Domain Coordinates for d1i3ra1:

Click to download the PDB-style file with coordinates for d1i3ra1.
(The format of our PDB-style files is described here.)

Timeline for d1i3ra1: