Lineage for d1i3of_ (1i3o F:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90881Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
  4. 90882Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 90883Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (3 proteins)
  6. 90893Protein BIR domains of XIAP [57928] (1 species)
  7. 90894Species Human (Homo sapiens) [TaxId:9606] [57929] (5 PDB entries)
  8. 90898Domain d1i3of_: 1i3o F: [61606]
    Other proteins in same PDB: d1i3o.1, d1i3o.2

Details for d1i3of_

PDB Entry: 1i3o (more details), 2.7 Å

PDB Description: crystal structure of the complex of xiap-bir2 and caspase 3

SCOP Domain Sequences for d1i3of_:

Sequence, based on SEQRES records: (download)

>d1i3of_ g.52.1.1 (F:) BIR domains of XIAP {Human (Homo sapiens)}
thadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltprelasaglyytgi
gdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnln

Sequence, based on observed residues (ATOM records): (download)

>d1i3of_ g.52.1.1 (F:) BIR domains of XIAP {Human (Homo sapiens)}
thadyllrtgqvvdisdtiyprnpamyseearlksltprelasaglyytgigdqvqcfac
ggklknwepgdrawsehrrhfpncffvlgrnln

SCOP Domain Coordinates for d1i3of_:

Click to download the PDB-style file with coordinates for d1i3of_.
(The format of our PDB-style files is described here.)

Timeline for d1i3of_: