SCOPe 2.07: Domain d1i3oe_: 1i3o E:

Lineage for d1i3oe_ (1i3o E:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR domains of XIAP [57928] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
   Uniprot P98170 241-356

8. Domain d1i3oe_: 1i3o E: [61605]
   Other proteins in same PDB: d1i3o.1, d1i3o.2
   BIR2 domain complexed to caspase 3
   complexed with zn

Details for d1i3oe_

PDB Entry: 1i3o, 2.7 Å

PDB Description: crystal structure of the complex of xiap-bir2 and caspase 3

PDB Compounds: (E:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d1i3oe_:

Sequence; same for both SEQRES and ATOM records:

>d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
faldrpsethadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltprelas
aglyytgigdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnlni

Timeline for d1i3oe_:

• d1i3oe_ first appeared in SCOP 1.57
  
• d1i3oe_ appears in SCOPe 2.06
  
• d1i3oe_ appears in the current release, SCOPe 2.08