![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.17: Caspase-like [52128] (1 superfamily) |
![]() | Superfamily c.17.1: Caspase-like [52129] (2 families) ![]() |
![]() | Family c.17.1.1: Caspase [52130] (4 proteins) |
![]() | Protein Apopain (caspase-3, cpp32) [52131] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52132] (4 PDB entries) |
![]() | Domain d1i3o.1: 1i3o A:,B: [61603] Other proteins in same PDB: d1i3oe_, d1i3of_ |
PDB Entry: 1i3o (more details), 2.7 Å
SCOP Domain Sequences for d1i3o.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1i3o.1 c.17.1.1 (A:,B:) Apopain (caspase-3, cpp32) {Human (Homo sapiens)} sldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndl treeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsl tgkpklfiiqaargteldcgietXsgvdddmachkipveadflyaystapgyyswrnskd gswfiqslcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltk elyfy
Timeline for d1i3o.1: