SCOP 1.63: Domain d1i3ea_: 1i3e A:

Lineage for d1i3ea_ (1i3e A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (97 PDB entries)

8. Domain d1i3ea_: 1i3e A: [61589]
   Other proteins in same PDB: d1i3eb_
   hemoglobin Bart's (gamma4)
   complexed with azi, hem

Details for d1i3ea_

PDB Entry: 1i3e, 1.86 Å

PDB Description: human azido-met hemoglobin bart's (gamma4)

SCOP Domain Sequences for d1i3ea_:

Sequence; same for both SEQRES and ATOM records:

>d1i3ea_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

Timeline for d1i3ea_:

• d1i3ea_ first appeared in SCOP 1.57
  
• d1i3ea_ appears in SCOP 1.61
  
• d1i3ea_ appears in SCOP 1.65
  
• d1i3ea_ appears in the current release, SCOPe 2.08