Lineage for d1i3da_ (1i3d A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716690Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1717270Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)
  8. 1717271Domain d1i3da_: 1i3d A: [61587]
    hemoglobin Bart's (gamma4)
    complexed with cmo, hem

Details for d1i3da_

PDB Entry: 1i3d (more details), 1.7 Å

PDB Description: human carbonmonoxy hemoglobin bart's (gamma4)
PDB Compounds: (A:) hemoglobin gamma chains

SCOPe Domain Sequences for d1i3da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3da_ a.1.1.2 (A:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain [TaxId: 9606]}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

SCOPe Domain Coordinates for d1i3da_:

Click to download the PDB-style file with coordinates for d1i3da_.
(The format of our PDB-style files is described here.)

Timeline for d1i3da_: