SCOP 1.57: Domain d1i3da_: 1i3d A:

Lineage for d1i3da_ (1i3d A:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (17 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (14 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (73 PDB entries)

8. Domain d1i3da_: 1i3d A: [61587]
   Other proteins in same PDB: d1i3db_

Details for d1i3da_

PDB Entry: 1i3d, 1.7 Å

PDB Description: human carbonmonoxy hemoglobin bart's (gamma4)

SCOP Domain Sequences for d1i3da_:

Sequence; same for both SEQRES and ATOM records:

>d1i3da_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

Timeline for d1i3da_:

• d1i3da_ is new in SCOP 1.57
  
• d1i3da_ appears in SCOP 1.59
  
• d1i3da_ appears in the current release, SCOPe 2.08