SCOPe 2.08: Domain d1i3da_: 1i3d A:

Lineage for d1i3da_ (1i3d A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)

8. Domain d1i3da_: 1i3d A: [61587]
   hemoglobin Bart's (gamma4)
   complexed with cmo, hem

Details for d1i3da_

PDB Entry: 1i3d, 1.7 Å

PDB Description: human carbonmonoxy hemoglobin bart's (gamma4)

PDB Compounds: (A:) hemoglobin gamma chains

SCOPe Domain Sequences for d1i3da_:

Sequence; same for both SEQRES and ATOM records:

>d1i3da_ a.1.1.2 (A:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain [TaxId: 9606]}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

Timeline for d1i3da_:

• d1i3da_ first appeared in SCOP 1.57
  
• d1i3da_ appears in SCOPe 2.07