Lineage for d1i39a_ (1i39 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124495Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 124496Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 124497Protein Class II ribonuclease H (RNase HII) [53103] (3 species)
  7. 124498Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [64093] (2 PDB entries)
  8. 124499Domain d1i39a_: 1i39 A: [61585]

Details for d1i39a_

PDB Entry: 1i39 (more details), 1.95 Å

PDB Description: rnase hii from archaeoglobus fulgidus

SCOP Domain Sequences for d1i39a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i39a_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Archaeoglobus fulgidus}
mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte
vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl
rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias
gripscvrmrwktvsnlrqk

SCOP Domain Coordinates for d1i39a_:

Click to download the PDB-style file with coordinates for d1i39a_.
(The format of our PDB-style files is described here.)

Timeline for d1i39a_: