Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein Class II ribonuclease H (RNase HII) [53103] (5 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [64093] (2 PDB entries) |
Domain d1i39a_: 1i39 A: [61585] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1i39 (more details), 1.95 Å
SCOPe Domain Sequences for d1i39a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i39a_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeoglobus fulgidus [TaxId: 2234]} mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias gripscvrmrwktvsnlrqk
Timeline for d1i39a_: