![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
![]() | Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) ![]() |
![]() | Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein) incomplete barrel of 6 strands, the last PK strand is missing |
![]() | Protein ATP sulfurylase N-terminal domain [63802] (3 species) |
![]() | Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63804] (2 PDB entries) |
![]() | Domain d1i2dc1: 1i2d C:2-170 [61562] Other proteins in same PDB: d1i2da2, d1i2da3, d1i2db2, d1i2db3, d1i2dc2, d1i2dc3 complexed with adx |
PDB Entry: 1i2d (more details), 2.81 Å
SCOP Domain Sequences for d1i2dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i2dc1 b.58.1.2 (C:2-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum)} anaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmnq adydrvcednrladgnvfsmpitldasqevidekklqagsritlrdfrddrnlailtidd iyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhyd
Timeline for d1i2dc1: