Lineage for d1i2db3 (1i2d B:391-573)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180345Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein)
  6. 180346Protein ATP sulfurylase C-terminal domain [64012] (2 species)
  7. 180358Species Fungus (Penicillium chrysogenum) [TaxId:5076] [64014] (1 PDB entry)
  8. 180360Domain d1i2db3: 1i2d B:391-573 [61561]
    Other proteins in same PDB: d1i2da1, d1i2da2, d1i2db1, d1i2db2, d1i2dc1, d1i2dc2

Details for d1i2db3

PDB Entry: 1i2d (more details), 2.81 Å

PDB Description: crystal structure of atp sulfurylase from penicillium chrysogenum

SCOP Domain Sequences for d1i2db3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2db3 c.37.1.15 (B:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum)}
pratqgftifltgymnsgkdaiaralqvtlnqqggrsvslllgdtvrhelsselgftred
rhtniqriafvateltragaaviaapiapyeesrkfardavsqagsfflvhvatplehce
qsdkrgiyaaarrgeikgftgvddpyetpekadlvvdfskqsvrsivheiilvlesqgfl
erq

SCOP Domain Coordinates for d1i2db3:

Click to download the PDB-style file with coordinates for d1i2db3.
(The format of our PDB-style files is described here.)

Timeline for d1i2db3: