Lineage for d1i2da1 (1i2d A:2-170)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232326Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 232327Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 232418Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein)
    incomplete barrel of 6 strands, the last PK strand is missing
  6. 232419Protein ATP sulfurylase N-terminal domain [63802] (3 species)
  7. 232431Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63804] (2 PDB entries)
  8. 232435Domain d1i2da1: 1i2d A:2-170 [61556]
    Other proteins in same PDB: d1i2da2, d1i2da3, d1i2db2, d1i2db3, d1i2dc2, d1i2dc3

Details for d1i2da1

PDB Entry: 1i2d (more details), 2.81 Å

PDB Description: crystal structure of atp sulfurylase from penicillium chrysogenum

SCOP Domain Sequences for d1i2da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2da1 b.58.1.2 (A:2-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum)}
anaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmnq
adydrvcednrladgnvfsmpitldasqevidekklqagsritlrdfrddrnlailtidd
iyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhyd

SCOP Domain Coordinates for d1i2da1:

Click to download the PDB-style file with coordinates for d1i2da1.
(The format of our PDB-style files is described here.)

Timeline for d1i2da1: