SCOP 1.73: Domain d1i27a_: 1i27 A:

Lineage for d1i27a_ (1i27 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.30: C-terminal domain of the rap74 subunit of TFIIF [63480] (1 protein)

6. Protein C-terminal domain of the rap74 subunit of TFIIF [63481] (1 species)
   peptide-recognition motif

7. Species Human (Homo sapiens) [TaxId:9606] [63482] (4 PDB entries)

8. Domain d1i27a_: 1i27 A: [61555]
   complexed with zn; mutant

Details for d1i27a_

PDB Entry: 1i27, 1.02 Å

PDB Description: crystal structure of the c-terminal domain of the rap74 subunit of human transcription factor iif (tfiif)

PDB Compounds: (A:) transcription factor iif

SCOP Domain Sequences for d1i27a_:

Sequence; same for both SEQRES and ATOM records:

>d1i27a_ a.4.5.30 (A:) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens) [TaxId: 9606]}
gplgsgdvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnper
kmindkmhfslke

Timeline for d1i27a_:

• d1i27a_ first appeared in SCOP 1.57
  
• d1i27a_ appears in SCOP 1.71
  
• d1i27a_ appears in SCOP 1.75
  
• d1i27a_ appears in the current release, SCOPe 2.08, called d1i27a1