Lineage for d1i10h1 (1i10 H:1-159)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118692Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 118699Protein Lactate dehydrogenase [51859] (11 species)
  7. 118723Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (1 PDB entry)
  8. 118731Domain d1i10h1: 1i10 H:1-159 [61513]
    Other proteins in same PDB: d1i10a2, d1i10b2, d1i10c2, d1i10d2, d1i10e2, d1i10f2, d1i10g2, d1i10h2

Details for d1i10h1

PDB Entry: 1i10 (more details), 2.3 Å

PDB Description: human muscle l-lactate dehydrogenase m chain, ternary complex with nadh and oxamate

SCOP Domain Sequences for d1i10h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i10h1 c.2.1.5 (H:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain)}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOP Domain Coordinates for d1i10h1:

Click to download the PDB-style file with coordinates for d1i10h1.
(The format of our PDB-style files is described here.)

Timeline for d1i10h1: