Lineage for d1i10g1 (1i10 G:1-159)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478258Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 478281Protein Lactate dehydrogenase [51859] (13 species)
  7. 478309Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (1 PDB entry)
  8. 478316Domain d1i10g1: 1i10 G:1-159 [61511]
    Other proteins in same PDB: d1i10a2, d1i10b2, d1i10c2, d1i10d2, d1i10e2, d1i10f2, d1i10g2, d1i10h2

Details for d1i10g1

PDB Entry: 1i10 (more details), 2.3 Å

PDB Description: human muscle l-lactate dehydrogenase m chain, ternary complex with nadh and oxamate

SCOP Domain Sequences for d1i10g1:

Sequence, based on SEQRES records: (download)

>d1i10g1 c.2.1.5 (G:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain)}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d1i10g1 c.2.1.5 (G:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain)}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqnlvqrnvnifkfiipnvvky
spnckllivsnpvdiltyvawkisgfpknrvig

SCOP Domain Coordinates for d1i10g1:

Click to download the PDB-style file with coordinates for d1i10g1.
(The format of our PDB-style files is described here.)

Timeline for d1i10g1: