Lineage for d1i10d2 (1i10 D:160-331)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85227Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 85228Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 85229Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 85236Protein Lactate dehydrogenase [56339] (10 species)
  7. 85260Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (1 PDB entry)
  8. 85264Domain d1i10d2: 1i10 D:160-331 [61506]
    Other proteins in same PDB: d1i10a1, d1i10b1, d1i10c1, d1i10d1, d1i10e1, d1i10f1, d1i10g1, d1i10h1

Details for d1i10d2

PDB Entry: 1i10 (more details), 2.3 Å

PDB Description: human muscle l-lactate dehydrogenase m chain, ternary complex with nadh and oxamate

SCOP Domain Sequences for d1i10d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i10d2 d.162.1.1 (D:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain)}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOP Domain Coordinates for d1i10d2:

Click to download the PDB-style file with coordinates for d1i10d2.
(The format of our PDB-style files is described here.)

Timeline for d1i10d2: