Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
Protein Lactate dehydrogenase [51859] (13 species) |
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (1 PDB entry) |
Domain d1i10c1: 1i10 C:1-159 [61503] Other proteins in same PDB: d1i10a2, d1i10b2, d1i10c2, d1i10d2, d1i10e2, d1i10f2, d1i10g2, d1i10h2 |
PDB Entry: 1i10 (more details), 2.3 Å
SCOP Domain Sequences for d1i10c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i10c1 c.2.1.5 (C:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain)} atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d1i10c1: