Lineage for d1i0zb2 (1i0z B:161-332)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2998819Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [64444] (4 PDB entries)
  8. 2998821Domain d1i0zb2: 1i0z B:161-332 [61498]
    Other proteins in same PDB: d1i0za1, d1i0zb1
    complexed with nai, oxm

Details for d1i0zb2

PDB Entry: 1i0z (more details), 2.1 Å

PDB Description: human heart l-lactate dehydrogenase h chain, ternary complex with nadh and oxamate
PDB Compounds: (B:) l-lactate dehydrogenase h chain

SCOPe Domain Sequences for d1i0zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0zb2 d.162.1.1 (B:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}
sgcnldsarfrylmaeklgihpsschgwilgehgdssvavwsgvnvagvslqelnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvkgm
ygienevflslpcilnargltsvinqklkddevaqlkksadtlwdiqkdlkd

SCOPe Domain Coordinates for d1i0zb2:

Click to download the PDB-style file with coordinates for d1i0zb2.
(The format of our PDB-style files is described here.)

Timeline for d1i0zb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0zb1