Lineage for d1i0za1 (1i0z A:1-160)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118692Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 118699Protein Lactate dehydrogenase [51859] (11 species)
  7. 118720Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [63939] (1 PDB entry)
  8. 118721Domain d1i0za1: 1i0z A:1-160 [61495]
    Other proteins in same PDB: d1i0za2, d1i0zb2

Details for d1i0za1

PDB Entry: 1i0z (more details), 2.1 Å

PDB Description: human heart l-lactate dehydrogenase h chain, ternary complex with nadh and oxamate

SCOP Domain Sequences for d1i0za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain)}
atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig

SCOP Domain Coordinates for d1i0za1:

Click to download the PDB-style file with coordinates for d1i0za1.
(The format of our PDB-style files is described here.)

Timeline for d1i0za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0za2