![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries) Uniprot P01130 272-353 |
![]() | Domain d1i0ua1: 1i0u A:1-41 [61493] complexed with ca |
PDB Entry: 1i0u (more details)
SCOPe Domain Sequences for d1i0ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0ua1 g.3.11.1 (A:1-41) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced
Timeline for d1i0ua1: