Lineage for d1i0ca_ (1i0c A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053842Protein EPS8 SH3 domain [50082] (1 species)
  7. 2053843Species Mouse (Mus musculus) [TaxId:10090] [50083] (3 PDB entries)
  8. 2053846Domain d1i0ca_: 1i0c A: [61485]

Details for d1i0ca_

PDB Entry: 1i0c (more details), 2 Å

PDB Description: eps8 sh3 closed monomer
PDB Compounds: (A:) epidermal growth factor receptor kinase substrate eps8

SCOPe Domain Sequences for d1i0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ca_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
kkyakskydfvarnsselsvmkddvleilddrrqwwkvrnasgdsgfvpnnildimrtp

SCOPe Domain Coordinates for d1i0ca_:

Click to download the PDB-style file with coordinates for d1i0ca_.
(The format of our PDB-style files is described here.)

Timeline for d1i0ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i0cb_