Lineage for d1hzxa_ (1hzx A:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 141754Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins)
  6. 141794Protein Rhodopsin [56876] (1 species)
  7. 141795Species Cow (Bos taurus) [TaxId:9913] [56877] (3 PDB entries)
  8. 141796Domain d1hzxa_: 1hzx A: [61466]

Details for d1hzxa_

PDB Entry: 1hzx (more details), 2.8 Å

PDB Description: crystal structure of bovine rhodopsin

SCOP Domain Sequences for d1hzxa_:

Sequence, based on SEQRES records: (download)

>d1hzxa_ f.2.1.1 (A:) Rhodopsin {Cow (Bos taurus)}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa

Sequence, based on observed residues (ATOM records): (download)

>d1hzxa_ f.2.1.1 (A:) Rhodopsin {Cow (Bos taurus)}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaattqk
aekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsavynpvi
yimmnkqfrncmvttlccgknplgdsttvsktetsqvapa

SCOP Domain Coordinates for d1hzxa_:

Click to download the PDB-style file with coordinates for d1hzxa_.
(The format of our PDB-style files is described here.)

Timeline for d1hzxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hzxb_