Lineage for d1hzia_ (1hzi A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354365Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 354366Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 354434Family a.26.1.2: Short-chain cytokines [47286] (11 proteins)
  6. 354481Protein Interleukin-4 (IL-4) [47291] (1 species)
  7. 354482Species Human (Homo sapiens) [TaxId:9606] [47292] (13 PDB entries)
  8. 354483Domain d1hzia_: 1hzi A: [61449]
    complexed with so4; mutant

Details for d1hzia_

PDB Entry: 1hzi (more details), 2.05 Å

PDB Description: interleukin-4 mutant e9a

SCOP Domain Sequences for d1hzia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzia_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens)}
hkcditlqaiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
kdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktim
rekyskcss

SCOP Domain Coordinates for d1hzia_:

Click to download the PDB-style file with coordinates for d1hzia_.
(The format of our PDB-style files is described here.)

Timeline for d1hzia_: