SCOPe 2.05: Domain d1hzhm2: 1hzh M:108-214

Lineage for d1hzhm2 (1hzh M:108-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1hzhm2: 1hzh M:108-214 [61448]
   Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk1, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl1, d1hzhm1
   part of intact IgG B12 antibody

Details for d1hzhm2

PDB Entry: 1hzh, 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

PDB Compounds: (M:) immunoglobulin light chain

SCOPe Domain Sequences for d1hzhm2:

Sequence; same for both SEQRES and ATOM records:

>d1hzhm2 b.1.1.2 (M:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

Timeline for d1hzhm2:

• d1hzhm2 first appeared in SCOP 1.57
  
• d1hzhm2 appears in SCOPe 2.04
  
• d1hzhm2 appears in SCOPe 2.06
  
• d1hzhm2 appears in the current release, SCOPe 2.08