Lineage for d1hzhl2 (1hzh L:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 656084Domain d1hzhl2: 1hzh L:108-214 [61446]
    Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk1, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl1, d1hzhm1

Details for d1hzhl2

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design
PDB Compounds: (L:) immunoglobulin light chain

SCOP Domain Sequences for d1hzhl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

SCOP Domain Coordinates for d1hzhl2:

Click to download the PDB-style file with coordinates for d1hzhl2.
(The format of our PDB-style files is described here.)

Timeline for d1hzhl2: