SCOP 1.63: Domain d1hzhl1: 1hzh L:1-107

Lineage for d1hzhl1 (1hzh L:1-107)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Intact IgG B12 antibody (human), kappa L chain [63639] (1 PDB entry)
Domain d1hzhl1: 1hzh L:1-107 [61445]
Other proteins in same PDB: d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl2, d1hzhm2

Details for d1hzhl1

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain}
eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk

SCOP Domain Coordinates for d1hzhl1:

Click to download the PDB-style file with coordinates for d1hzhl1.
(The format of our PDB-style files is described here.)

Timeline for d1hzhl1: