Lineage for d1hzhk4 (1hzh K:360-475)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453852Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 453855Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries)
  8. 453868Domain d1hzhk4: 1hzh K:360-475 [61444]
    Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh3, d1hzhk1, d1hzhk2, d1hzhk3, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2
    part of intact IgG B12 antibody

Details for d1hzhk4

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhk4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhk4 b.1.1.2 (K:360-475) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOP Domain Coordinates for d1hzhk4:

Click to download the PDB-style file with coordinates for d1hzhk4.
(The format of our PDB-style files is described here.)

Timeline for d1hzhk4: