![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
![]() | Domain d1hzhk3: 1hzh K:239-359 [61443] Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh4, d1hzhk1, d1hzhk2, d1hzhk4, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2 part of intact IgG B12 antibody |
PDB Entry: 1hzh (more details), 2.7 Å
SCOPe Domain Sequences for d1hzhk3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzhk3 b.1.1.2 (K:239-359) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d1hzhk3: