Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88585] (19 PDB entries) |
Domain d1hzhk3: 1hzh K:239-359 [61443] Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh4, d1hzhk1, d1hzhk2, d1hzhk4, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2 part of intact IgG B12 antibody complexed with fuc, gal, man, nag |
PDB Entry: 1hzh (more details), 2.7 Å
SCOP Domain Sequences for d1hzhk3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzhk3 b.1.1.2 (K:239-359) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)} cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d1hzhk3: