Lineage for d1hzhk3 (1hzh K:239-359)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289511Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 289512Species Human (Homo sapiens) [TaxId:9606] [88585] (19 PDB entries)
  8. 289523Domain d1hzhk3: 1hzh K:239-359 [61443]
    Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh4, d1hzhk1, d1hzhk2, d1hzhk4, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2
    part of intact IgG B12 antibody
    complexed with fuc, gal, man, nag

Details for d1hzhk3

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhk3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhk3 b.1.1.2 (K:239-359) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOP Domain Coordinates for d1hzhk3:

Click to download the PDB-style file with coordinates for d1hzhk3.
(The format of our PDB-style files is described here.)

Timeline for d1hzhk3: