Lineage for d1hzhk2 (1hzh K:114-235)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453271Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 453353Domain d1hzhk2: 1hzh K:114-235 [61442]
    Other proteins in same PDB: d1hzhh1, d1hzhh3, d1hzhh4, d1hzhk1, d1hzhk3, d1hzhk4, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2
    part of intact IgG B12 antibody

Details for d1hzhk2

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhk2:

Sequence, based on SEQRES records: (download)

>d1hzhk2 b.1.1.2 (K:114-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdk

Sequence, based on observed residues (ATOM records): (download)

>d1hzhk2 b.1.1.2 (K:114-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdk

SCOP Domain Coordinates for d1hzhk2:

Click to download the PDB-style file with coordinates for d1hzhk2.
(The format of our PDB-style files is described here.)

Timeline for d1hzhk2: