Lineage for d1hzhk1 (1hzh K:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 450971Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (16 PDB entries)
  8. 450989Domain d1hzhk1: 1hzh K:1-113 [61441]
    Other proteins in same PDB: d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2
    part of intact IgG B12 antibody

Details for d1hzhk1

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhk1 b.1.1.1 (K:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
ttvivss

SCOP Domain Coordinates for d1hzhk1:

Click to download the PDB-style file with coordinates for d1hzhk1.
(The format of our PDB-style files is described here.)

Timeline for d1hzhk1: