Lineage for d1hz8a2 (1hz8 A:42-82)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031503Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 3031504Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
    Uniprot P01130 272-353
  8. 3031511Domain d1hz8a2: 1hz8 A:42-82 [61433]
    complexed with ca

Details for d1hz8a2

PDB Entry: 1hz8 (more details)

PDB Description: solution structure and backbone dynamics of a concatemer of egf- homology modules of the human low density lipoprotein receptor
PDB Compounds: (A:) low density lipoprotein receptor

SCOPe Domain Sequences for d1hz8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hz8a2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
idecqdpdtcsqlcvnleggykcqceegfqldphtkackav

SCOPe Domain Coordinates for d1hz8a2:

Click to download the PDB-style file with coordinates for d1hz8a2.
(The format of our PDB-style files is described here.)

Timeline for d1hz8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hz8a1