Lineage for d1hz8a1 (1hz8 A:1-41)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88919Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 88920Species Human (Homo sapiens) [TaxId:9606] [64540] (4 PDB entries)
  8. 88923Domain d1hz8a1: 1hz8 A:1-41 [61432]

Details for d1hz8a1

PDB Entry: 1hz8 (more details)

PDB Description: solution structure and backbone dynamics of a concatemer of egf- homology modules of the human low density lipoprotein receptor

SCOP Domain Sequences for d1hz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hz8a1 g.3.11.1 (A:1-41) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens)}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced

SCOP Domain Coordinates for d1hz8a1:

Click to download the PDB-style file with coordinates for d1hz8a1.
(The format of our PDB-style files is described here.)

Timeline for d1hz8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hz8a2