SCOPe 2.07: Domain d1hz5a1: 1hz5 A:1-64

Lineage for d1hz5a1 (1hz5 A:1-64)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)

8. Domain d1hz5a1: 1hz5 A:1-64 [61427]
   Other proteins in same PDB: d1hz5a2, d1hz5b2
   b1 domain
   complexed with zn

Details for d1hz5a1

PDB Entry: 1hz5, 1.8 Å

PDB Description: crystal structures of the b1 domain of protein l from peptostreptococcus magnus, with a tyrosine to tryptophan substitution

PDB Compounds: (A:) protein l

SCOPe Domain Sequences for d1hz5a1:

Sequence; same for both SEQRES and ATOM records:

>d1hz5a1 d.15.7.1 (A:1-64) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
meevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlni
kfag

Timeline for d1hz5a1:

• d1hz5a1 first appeared in SCOP 1.57, called d1hz5a_
  
• d1hz5a1 appears in SCOPe 2.06
  
• d1hz5a1 appears in the current release, SCOPe 2.08