Lineage for d1hysd2 (1hys D:124-220)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655750Domain d1hysd2: 1hys D:124-220 [61423]
    Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb_, d1hysc1, d1hysc2, d1hysd1
    part of Fab 28 against HIV-1 RT
    mutant

Details for d1hysd2

PDB Entry: 1hys (more details), 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
PDB Compounds: (D:) fab-28 monoclonal antibody fragment heavy chain

SCOP Domain Sequences for d1hysd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hysd2 b.1.1.2 (D:124-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

SCOP Domain Coordinates for d1hysd2:

Click to download the PDB-style file with coordinates for d1hysd2.
(The format of our PDB-style files is described here.)

Timeline for d1hysd2: