SCOP 1.69: Domain d1hysd2: 1hys D:124-220

Lineage for d1hysd2 (1hys D:124-220)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1hysd2: 1hys D:124-220 [61423]
   Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb_, d1hysc1, d1hysc2, d1hysd1
   part of Fab 28 against HIV-1 RT

Details for d1hysd2

PDB Entry: 1hys, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysd2:

Sequence; same for both SEQRES and ATOM records:

>d1hysd2 b.1.1.2 (D:124-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

Timeline for d1hysd2:

• d1hysd2 first appeared in SCOP 1.57
  
• d1hysd2 appears in SCOP 1.67
  
• d1hysd2 appears in SCOP 1.71
  
• d1hysd2 appears in the current release, SCOPe 2.08