SCOP 1.59: Domain d1hysd2: 1hys D:124-220

Lineage for d1hysd2 (1hys D:124-220)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (3 PDB entries)

8. Domain d1hysd2: 1hys D:124-220 [61423]
   Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb1, d1hysc1, d1hysd1

Details for d1hysd2

PDB Entry: 1hys, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysd2:

Sequence; same for both SEQRES and ATOM records:

>d1hysd2 b.1.1.2 (D:124-220) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

Timeline for d1hysd2:

• d1hysd2 first appeared in SCOP 1.57
  
• d1hysd2 appears in SCOP 1.61
  
• d1hysd2 appears in the current release, SCOPe 2.08