Lineage for d1hysd1 (1hys D:1-123)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52046Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (3 PDB entries)
  8. 52050Domain d1hysd1: 1hys D:1-123 [61422]
    Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb1, d1hysc2, d1hysd2

Details for d1hysd1

PDB Entry: 1hys (more details), 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hysd1 b.1.1.1 (D:1-123) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d1hysd1:

Click to download the PDB-style file with coordinates for d1hysd1.
(The format of our PDB-style files is described here.)

Timeline for d1hysd1: