SCOP 1.65: Domain d1hysc2: 1hys C:108-214

Lineage for d1hysc2 (1hys C:108-214)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d1hysc2: 1hys C:108-214 [61421]
   Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb_, d1hysc1, d1hysd1, d1hysd2
   part of Fab 28 against HIV-1 RT
   mutant

Details for d1hysc2

PDB Entry: 1hys, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysc2:

Sequence; same for both SEQRES and ATOM records:

>d1hysc2 b.1.1.2 (C:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqd
skdstysmsstltltadayeaansytcaathktstspivksfnanec

Timeline for d1hysc2:

• d1hysc2 first appeared in SCOP 1.57
  
• d1hysc2 appears in SCOP 1.63
  
• d1hysc2 appears in SCOP 1.67
  
• d1hysc2 appears in the current release, SCOPe 2.08