Lineage for d1hysc2 (1hys C:108-214)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53514Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (3 PDB entries)
  8. 53517Domain d1hysc2: 1hys C:108-214 [61421]
    Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb1, d1hysc1, d1hysd1

Details for d1hysc2

PDB Entry: 1hys (more details), 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hysc2 b.1.1.2 (C:108-214) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqd
skdstysmsstltltadayeaansytcaathktstspivksfnanec

SCOP Domain Coordinates for d1hysc2:

Click to download the PDB-style file with coordinates for d1hysc2.
(The format of our PDB-style files is described here.)

Timeline for d1hysc2: