Lineage for d1hysc1 (1hys C:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219437Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (5 PDB entries)
  8. 219444Domain d1hysc1: 1hys C:1-107 [61420]
    Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb_, d1hysc2, d1hysd2

Details for d1hysc1

PDB Entry: 1hys (more details), 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hysc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleik

SCOP Domain Coordinates for d1hysc1:

Click to download the PDB-style file with coordinates for d1hysc1.
(The format of our PDB-style files is described here.)

Timeline for d1hysc1: