SCOP 1.57: Domain d1hysc1: 1hys C:1-107

Lineage for d1hysc1 (1hys C:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (3 PDB entries)

8. Domain d1hysc1: 1hys C:1-107 [61420]
   Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb1, d1hysc2, d1hysd2

Details for d1hysc1

PDB Entry: 1hys, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysc1:

Sequence; same for both SEQRES and ATOM records:

>d1hysc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleik

Timeline for d1hysc1:

• d1hysc1 is new in SCOP 1.57
  
• d1hysc1 appears in SCOP 1.59
  
• d1hysc1 appears in the current release, SCOPe 2.08