SCOP 1.73: Domain d1hysb_: 1hys B:

Lineage for d1hysb_ (1hys B:)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (90 PDB entries)

8. Domain d1hysb_: 1hys B: [61419]
   Other proteins in same PDB: d1hysa1, d1hysc1, d1hysc2, d1hysd1, d1hysd2
   mutant

Details for d1hysb_

PDB Entry: 1hys, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

PDB Compounds: (B:) hiv-1 reverse transcriptase

SCOP Domain Sequences for d1hysb_:

Sequence; same for both SEQRES and ATOM records:

>d1hysb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvkl

Timeline for d1hysb_:

• d1hysb_ first appeared in SCOP 1.57, called d1hysb1
  
• d1hysb_ appears in SCOP 1.71
  
• d1hysb_ appears in SCOP 1.75
  
• d1hysb_ appears in the current release, SCOPe 2.08